DPCstruct | MC3028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 224 ± 30 aa |
| Standard deviation of domain lengths | 29.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3GRA0 | 46-215 | TAVEKPKAPAASSNNASTKSTSAPRSSSQSSSGNKAADFYTETLKGQLVQSFLVRWWYAMEWPKMEEIGEPPAGYESLDGFPGVFIS… |
| A0CSW5 | 3-225 | NDLGVQKKKHKYIDSEEEEQQQQQPVQQPQEQSPIAQTITVDNQKWKYLFEPDSSEQQEEKKVKKIPNPQITKQKQPEQRVKQIKSN… |
| A0A1A8VPF1 | 376-624 | None |
| A0A5D6XZQ3 | 14-253 | None |
| D7FPR6 | 27-234 | None |
| W7U634 | 94-335 | None |
| A0A1R2D190 | 74-330 | None |
| A0A7S1EGP5 | 108-311 | None |
| A0A086L992 | 145-401 | None |
| A0A7S3ZR57 | 162-391 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.