DPCstruct | MC30277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 11.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812QZB6 | 876-971 | CLHSSHEKQDFWRLDRARGVIERVHRSPRWERFTPIGVGECPVEFGSIGVERTTIANLSSGKRIISSDIWVGSNAYLRENEAWTGIT… |
| A0A812P378 | 153-258 | TPDTWELDTENRVLIRRRNSWRSRMFVPTSLASCPVPADQFTGKRVTKWLDPQGGVGSFVDKWISARAPADRVYMKKWKGSTHVEYK… |
| A0A812P0D3 | 495-617 | None |
| A0A812KMB2 | 274-372 | None |
| A0A812V367 | 354-472 | None |
| A0A812JAB4 | 83-167 | None |
| A0A812IMV0 | 2-115 | None |
| A0A812PH91 | 151-252 | None |
| A0A813A289 | 499-601 | None |
| A0A812IIY7 | 29-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.