DPCstruct | MC3027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1155 |
|---|---|
| Mean domain length (aa) | 300 ± 72 aa |
| Standard deviation of domain lengths | 71.93 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 80.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 13.96 |
| Pfam Score | 98.88 |
| Assigned Pfam label(s) | PF03985- CL0111- CL0707- CL0063- CL0129 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0CSP2 | 44-344 | NLHNFDNEYYALTLRIGTPLQLIELLVDTGSSILWLANYTCDNCSILNRYKPYLSQTYIDFNQTYTQTYGQGECSGQFGQELFSIAD… |
| A0A093VCK2 | 7-203 | SMNKVKPVRQNTFYENVKTSLRIPVFAAYLKHQAPGAFDFGWIDSNKYTGEITYTGVDPTNGYWTITCDGFSIGDTISVLHSFHAIV… |
| A0A654HUJ3 | 20-252 | None |
| A0A6G1EP63 | 48-305 | None |
| A0A1V2LTD1 | 28-357 | None |
| A0A1A9A0K3 | 473-908 | None |
| A0A7C5NBX9 | 9-224 | None |
| A0A538QAB9 | 43-306 | None |
| A0A0D9XPU8 | 295-638 | None |
| A0A179IJV8 | 30-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.