DPCstruct | MC30269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 94 ± 14 aa |
| Standard deviation of domain lengths | 14.14 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 50.67 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | PF06297- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H9JSV8 | 8-117 | RHSQSDDDSGCALEEYTWVPPGLRPEQVHLYFSALPEDKVPYVNSVGERYRLKQLLQQLPPQDNEVRYCHALSDEERKELRLFSAQR… |
| M7BFM6 | 21-100 | EWAPPGLTQKLAIQYMELIPKDMQPVAGTEGASYRRRQLMRQLPIYDQDASHCHDLAESEIKLMEDFVKKYKSDALGVGE |
| A0A1B0AAU4 | 226-342 | None |
| T1EHT6 | 1-90 | None |
| A0A0R3Q366 | 19-102 | None |
| A0A0V0UE80 | 1-75 | None |
| A0A671VXI8 | 48-138 | None |
| A0A1I7V053 | 35-149 | None |
| A0A6A1QBN9 | 3-110 | None |
| A0A1A9X9J4 | 245-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.