DPCstruct | MC30267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 108 ± 23 aa |
| Standard deviation of domain lengths | 23.34 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 74.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0K5B7 | 63-141 | KELMFAGEPIPTLDADSFTCPVCGEHGHSASELVDHSVIHHKDDNTRVNCPLCVAVHGADPQLVDNIGAHFCDVHGPRR |
| H9JKU6 | 16-118 | GEALTLEQSQAYTCPFCNRMGFTDTGLMEHVTAEHADTTLAVVCPVCASMPGGEPNFVTDDFAGHLTLEHRTGTGGGGISSLSPSSR… |
| A0A3Q0IQ85 | 10-111 | None |
| A0A5E4BHD6 | 85-185 | None |
| A0A6P3VL14 | 129-231 | None |
| A0A818HNZ7 | 142-229 | None |
| A0A383ZKN7 | 10-87 | None |
| A0A1Y1L710 | 68-144 | None |
| A0A0M4ESD1 | 56-202 | None |
| A0A6I8P5V0 | 513-634 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.