DPCstruct | MC30265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 70 ± 3 aa |
| Standard deviation of domain lengths | 2.97 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 79.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8RNA9 | 1-71 | MRARYLGPYLVVSRNRGGAYILSELDGAVFDRPIAAFRVLPYLARREPIAFQPNILDTDSRRIRELEASTD |
| A0A0L6X1V2 | 1-73 | MSACYWGPMVVLTRTKGGNYIVAELDGTVWQERVAAFRVILYKARQHITLPTSIEKWIDITPSKLQELKGATT |
| B0DDX7 | 1-65 | None |
| A0A284RBU6 | 572-645 | None |
| A0A0L6WF59 | 1-68 | None |
| A0A284SC82 | 347-417 | None |
| A0A067S407 | 263-330 | None |
| D8QJM9 | 949-1020 | None |
| A0A0L6WRV1 | 478-543 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.