DPCstruct | MC30264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 86 ± 4 aa |
| Standard deviation of domain lengths | 4.37 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496MJC2 | 1-87 | MDKTHNISLGGFSFIIENGAASQLSAYLTKVRQYLGQSADTDEILTDVEQRMAELLRARMQNTEVVTSSDIDYLIQVMGKPEQYVQD |
| A0A520CJ73 | 1-89 | MKKTIIINIGNSIIHIEEDAYEILTAYLNEIKQHFAKNADDFEIVTDIENRIAEMFAEILEAGKKQVIEITDVQNVIAQMGSVKDFI… |
| A0A2E1DY64 | 1-85 | None |
| A0A060R911 | 1-86 | None |
| A0A1I1KFH9 | 1-85 | None |
| A0A150WZD7 | 1-79 | None |
| A0A2H0UP82 | 1-88 | None |
| A0A136L7B7 | 1-83 | None |
| A0A3N2M8Z2 | 1-89 | None |
| A0A286IK20 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.