DPCstruct | MC30253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 53 ± 4 aa |
| Standard deviation of domain lengths | 4.47 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 52.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A364VBV1 | 20-74 | NDVHVAVWPTNDLVRHDIATNECVCGPQVVPRPRPEGGMGWMYKHHSLDGRENRE |
| A0A3Q9CTN8 | 3-50 | TLHVLPVDDLIDHTDSEDCICGPTIESIQHDDGTIDWVITHHSLDGRE |
| C6WC43 | 28-76 | None |
| A0A1S2GEZ8 | 6-57 | None |
| A0A5C7MQ72 | 2-59 | None |
| A0A561ENJ1 | 83-146 | None |
| A0A7K0PEM6 | 12-64 | None |
| A0A5S5CQ87 | 2-53 | None |
| A0A6G2VK65 | 2-52 | None |
| A0A495JX07 | 1-51 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.