DPCstruct | MC30251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 197 ± 51 aa |
| Standard deviation of domain lengths | 50.83 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 78.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20874 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N3H607 | 1-272 | MEQKIDLLTDDFAVLQVNYSILPDLQVGDGEIQVVVANADLAKVEHWYRMYQEQCLTEGKEIPDFQTMDMGKYRETGVMKEEAYVDT… |
| T0SIQ1 | 6-158 | DLDDFKTKAKALNLAVDFSGKWATYRLLDDVQVRNTRGRNLVKSDPERYNLDRIEAHLKKNTGMFSVADVVNQYEEKIETIKNDFDY… |
| A0A4U9Z5P5 | 114-312 | None |
| A0A1T4KW87 | 181-332 | None |
| A0A2X3RX55 | 15-183 | None |
| A0A123VU81 | 62-268 | None |
| A0A2V2FEI8 | 117-267 | None |
| F9HCG1 | 1-177 | None |
| A0A3E5AL42 | 30-336 | None |
| A0A6G6AUU0 | 87-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.