DPCstruct | MC3025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 295 ± 34 aa |
| Standard deviation of domain lengths | 34.13 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.16 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0YFZ5 | 1-260 | MKLHPRGVGGVDRLAETDIEGSKPRPLHFKTERHVNPLCPEYTLPSCALDMPPVPKFVRDGYGISDIEGTAPRSRFRFAQRETYDVK… |
| A0CS50 | 34-305 | RSQSTMTIQGIDGAAPKLKPYQYLNKEQFCNRDDDIPGTKSRPLIRVSNRSDNQLMIDDIKGTRPKVNKFSTNREPINPLEPVYKVA… |
| A0A067C8A0 | 1-302 | None |
| A0A024G0S6 | 33-368 | None |
| A0A2P4X5K5 | 2-262 | None |
| I7MH51 | 42-386 | None |
| A0A078A9K8 | 18-311 | None |
| A0A1R2AP11 | 9-282 | None |
| A0A7S3D195 | 28-279 | None |
| A0A1R2BZJ1 | 22-374 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.