DPCstruct | MC30246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 244 ± 22 aa |
| Standard deviation of domain lengths | 22.47 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G9YG26 | 337-582 | AAAGSPTGVTAALDAAIDDSPYRRNAFRLADLPTDADGRRIRKRVTELEAAERLGAPLALTPLLPTPSQPEPGEAKTALNQLREPAQ… |
| A0A7V2IPA4 | 24-284 | GRLLGRPFNVAVMDIDVTGRLYGQNGFRFAATSANVDPGVLERAAQRVRHLEKLKPGAACGAAIRLGYDDHLEVMDAADCVHRLSDP… |
| A0A6P2B5E6 | 48-327 | None |
| A0A4R7UQX3 | 13-241 | None |
| A0A1H0TGU6 | 17-266 | None |
| A0A1G9UMN9 | 96-301 | None |
| A0A450SDQ6 | 18-274 | None |
| A0A1I2E8G2 | 5-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.