DPCstruct | MC30244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 402 |
|---|---|
| Mean domain length (aa) | 114 ± 21 aa |
| Standard deviation of domain lengths | 20.79 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.17 |
| Pfam Score | 60.16 |
| Assigned Pfam label(s) | PF02720- CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I1YR83 | 4-69 | RDRECRADGCTIPATWCEAHHRQPWSAGGKTDLDNGMLLCSHHHHLIHDDRYLHQRMPNGDLRFVR |
| A0A841NY44 | 15-117 | TPSTNLDGRPGRRLPGPGLRRYVQIRDRTCTAPGCRRPATQSEQDHIHDHQYGGATTSTNLGPGCKYDHRLKHEGGWTVTQPRPGRF… |
| A0A538Q7F4 | 266-369 | None |
| A0A7Y3B7L1 | 2-79 | None |
| A0A538Q5K5 | 187-299 | None |
| A0A7I0EHJ6 | 36-162 | None |
| A0A4V2MBW9 | 152-280 | None |
| A0A851HS25 | 1-92 | None |
| A0A221Q8F9 | 293-412 | None |
| A0A537ZUG8 | 61-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.