DPCstruct | MC3024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 225 ± 42 aa |
| Standard deviation of domain lengths | 41.80 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 18.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01508 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0CGU2 | 376-557 | ESNCNRFMPTCTLINDKCGVRTCNTYQTEKLCSIDYQNQQCVWSGSCVVRTCQNAGDEYNTHSECQSWLNICTVQKGLIGCQTQELT… |
| A0CPL5 | 2-211 | CKWKSNSCQFKRCEEIISVQECYRLKYCFYNSIDQKCQELTDCSMLTAASQTECTDQSMYCGIYNSELKQCQALSIKNCNMYTTQQE… |
| A0DE68 | 118-401 | None |
| A0DN50 | 24-306 | None |
| A0DU94 | 8-215 | None |
| A0DUD4 | 2-233 | None |
| F0XXZ8 | 155-292 | None |
| A0A6U4XN14 | 11-193 | None |
| A0A7S1L7W5 | 10-166 | None |
| A0BWG0 | 289-507 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.