DPCstruct | MC30238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 85 ± 12 aa |
| Standard deviation of domain lengths | 11.76 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7SQZ5 | 2-67 | LHAIAAGRAETTTSCEPDLFVDGLACCDQIAAHHLAHAGLMRAAGPAKEGQRVPAELTTPGHVVLA |
| A0A7W8NPL9 | 1-82 | MSRVLTQAEARVLRALRDGAELTRHTRVERGPYYLMQGRRLSMPLVKQLEEKRLIAPDQSRGSTTTSYTLTPAGHEALEDLQ |
| A0A2J5Q0B3 | 1-77 | None |
| A0A4R1DBF6 | 2-91 | None |
| A0A6N7H4Y3 | 2-72 | None |
| A0A4R2R475 | 2-81 | None |
| A0A7W6SXS3 | 1-91 | None |
| A0A0N1GUB8 | 76-201 | None |
| A0A7X5X2U1 | 42-138 | None |
| A0A3M1IWW9 | 8-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.