DPCstruct | MC30232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 128 ± 24 aa |
| Standard deviation of domain lengths | 24.15 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.23 |
| Pfam Score | 98.33 |
| Assigned Pfam label(s) | CL0108- PF20906 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0JN59 | 4-112 | ITLFVKGEVIQSEWKDAMGFIEGNIVIESFADKEKYTIWFRNENMYLKKNDELISIAPEIISILHADTGEPILNPYCEIGMKVAVVN… |
| A0A0M0BL28 | 182-313 | IGRAIREAKEGGLDVRSEFVKTSDAVSLLDGSWGDWHIEGMGRYSGHRMRVWFKNENLISWLDGESHIMCPDLICIVEKEGFEGTSN… |
| W7ZAE9 | 125-235 | None |
| A0A1K1XBV3 | 105-237 | None |
| H0EUE2 | 434-601 | None |
| A0A251WN50 | 40-140 | None |
| K9Q4E5 | 272-407 | None |
| A0A7J3T9M2 | 1-87 | None |
| A0A6M0F3W1 | 318-454 | None |
| A0A7Z9N506 | 9-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.