DPCstruct | MC30225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 276 |
|---|---|
| Mean domain length (aa) | 241 ± 56 aa |
| Standard deviation of domain lengths | 56.29 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 79.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 10.89 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | CL0373- CL0127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L4Q338 | 2-136 | GANSQKLASWSTVGKAADDVIQAMIALDEAGYHGPYALTLAPARFNLLYRRYVQGIGTELEHLKSIVTDGIFKAPVLKTGGVLIATG… |
| A0A6M3IJI1 | 13-250 | DYTKNQDLVIERPESPNVTLLIDKAKYFNFICDDIDKYQTHLPLMDSWSTDAGQQMKITIETAVFADIYADAHTNNAGNSAGRISGD… |
| K2D7Z7 | 42-300 | None |
| A0A0E8EAR0 | 7-141 | None |
| A0A3G9HYG8 | 10-215 | None |
| A0A1V5X6N2 | 7-159 | None |
| A0A1H6U411 | 88-318 | None |
| A0A6I7MB86 | 20-225 | None |
| A0A7X8DBA4 | 4-182 | None |
| A0A090N7J7 | 10-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.