DPCstruct | MC30222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 161 ± 17 aa |
| Standard deviation of domain lengths | 17.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20081 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5L761 | 3-147 | DVETARLLAVIALAYPTFEVSPQKVALWHDMLQSVDFSLAQRATRRHIAESKWAPTVAEILDACREVAYGPQLAAGDVWHQLITAVR… |
| A0A6H2A5W7 | 2-168 | LNKGKFIELLSGICDIYEKTPSEFMFGMYYEIFQNYEYSEVETAFKNCLRNRVYSTFPKPAEILEYLEGTKDDKALAAWLEARKACE… |
| A0A0F8YZ54 | 1-155 | None |
| A0A6L2ZTC0 | 3-159 | None |
| A0A1Y4CYJ4 | 1-188 | None |
| A0A016QSL9 | 1-150 | None |
| A0A2S5MFC4 | 11-178 | None |
| S7HT77 | 2-155 | None |
| A0A3D5W4Z6 | 1-140 | None |
| A0A848C1Q3 | 1-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.