DPCstruct | MC3022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 150 ± 31 aa |
| Standard deviation of domain lengths | 31.31 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9CRA8 | 17-144 | EPDDIPHTKDPVWILGKKYSAIYDVEMIRRDIRTKLWFTYRRGFVPIGDTGLTTDKGWGCMLRCGQMVLAQALVHLHLGREWNWHPE… |
| A0CCT8 | 15-173 | SNYFYRALFQYEVKEEGYIMGKLIESKEDILDVVIHTIRFTYREGFQAYQCQNSTLTTDSGWGCVIRVGQMMMAELLKRHLKCFYNV… |
| A0A0V0QZW2 | 72-259 | None |
| A0A1I8IC84 | 220-372 | None |
| B7ZAY9 | 98-280 | None |
| F4Q5K2 | 164-336 | None |
| A0A146I4Z0 | 14-215 | None |
| A0A6P5FH66 | 20-174 | None |
| A0A835J211 | 15-158 | None |
| A0A6P4B1I0 | 45-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.