DPCstruct | MC30211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 295 ± 55 aa |
| Standard deviation of domain lengths | 54.80 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2R5R1 | 34-279 | IFSLPPEIIHILIRISVENLKRTKNLSIDKKKEIRRYIRKKLRKRYVVELVHGTYCPACGEFNTKEHLTAFHFNHENKKRKSINASD… |
| A0A0F9CZR8 | 15-287 | LHHIMIYDFYYIFFKDFINYNKLFNFSAEEIFIILKVIIHNFRLTMNLSKKKKRNIIKIIKNRIKKKYIIEQLYGNKCHICGEFDTK… |
| A0A0F9GEG2 | 169-502 | None |
| A0A0F9W4T2 | 110-409 | None |
| A0A0F9AAY9 | 31-268 | None |
| A0A5C9EHW6 | 203-513 | None |
| A0A0F8VA17 | 41-321 | None |
| A0A524EAR1 | 258-553 | None |
| A0A524FBC9 | 449-741 | None |
| A0A524EVG4 | 5-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.