DPCstruct | MC3021
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 124 ± 18 aa |
| Standard deviation of domain lengths | 18.43 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0CMR6 | 197-296 | EETNSKKNQKTKQRTLSQVVERVALWRRLYTGFYDQNKTFVQMSLDKAAEKVGISKKTLDDYLLQIRYGKRYGFDFKKNSNEGISKL… |
| A0C8C8 | 1-150 | MYTTDFQDIDSKRVKERLVESAFNKVQIWRKIFLEGLINEQGERQYYTLNEAANLVGIPKKTLEDYTQIFQKVGLIASPLSDFYGKK… |
| A0BS90 | 1-122 | None |
| G0R0M4 | 77-183 | None |
| G0QNX1 | 137-263 | None |
| A0DH96 | 4-159 | None |
| A0DCD2 | 1-145 | None |
| A0A078B6P0 | 102-201 | None |
| A0D554 | 1-111 | None |
| A0A1R2C571 | 133-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.