DPCstruct | MC30209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 116 ± 7 aa |
| Standard deviation of domain lengths | 7.11 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 40.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9CVH2 | 1-135 | MCHAAIVAMGYSPALGFIHTGKQLSFVYDIADLYKSDITIPLAFDIVKEGDTDISRRVRKECREIFRRKKFLKELVKDIKNVLDIKD… |
| A0A133ZAJ8 | 58-167 | AHAVIVGLGFIPSLGIVHSGTDRSFVFDIADLYKAELAIPAAFDVVASGVEDVDGATRTHLRSLIVSSRLMSRMVRDLQYLMEVPEA… |
| A0A645I640 | 1-120 | None |
| A0A497BFW7 | 190-297 | None |
| A0A1C4RKY9 | 442-558 | None |
| A0A426QB08 | 120-234 | None |
| A0A1Y2T1G3 | 1-114 | None |
| A0A1X7HGT1 | 71-184 | None |
| A0A6G9XXB6 | 141-252 | None |
| A0A3M2M3C0 | 91-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.