DPCstruct | MC30204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 94 ± 5 aa |
| Standard deviation of domain lengths | 4.97 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 48.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08385 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7NZ47 | 11-103 | SLLYAIETTVVEWSNQINEILAQDSGQPVAEGQAPMPMYEYDFWNQRMTCMHDIYDQLVHPKVKKMASILEEHQSAYAAPFKEMFKK… |
| A0A7J8G6X6 | 191-279 | HAIETIIIDWSHQVRDVLSKDSAQALLDGLQPLPRVEFEFWDARLQNLKCIHDQLNRPKVNKIVEILEKAKSCYWPALQNVYLNVTE… |
| S7Q6D2 | 64-152 | None |
| S4RY57 | 95-183 | None |
| A0A7R9DX96 | 282-382 | None |
| A0A452J4J6 | 11-100 | None |
| A0A183KIH4 | 99-195 | None |
| A0A183W838 | 1-91 | None |
| A0A151MUR9 | 174-278 | None |
| G7NIS6 | 165-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.