DPCstruct | MC30201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Standard deviation of domain lengths | 12.81 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A430Q0T7 | 206-295 | INKKIQEKFKVCLRYFLPPEWPMEKDQIHTLTDSDLASFPLEDFFDRYEQGLRSLLATFQQETKICSDRLTELRFNVCELLKKYDPV… |
| A0A2H1CII2 | 6-111 | KRIHEKFKVCLRYFLPPEWPMQKDQIHTLTETELANFPLEDFFDRYEQGLRSLLATFQQETKVCVERLEDLRSNVVKLLQHIEPSSS… |
| A0A183WAX8 | 1-89 | None |
| V4B9M0 | 377-492 | None |
| A0A5J4P3D9 | 80-187 | None |
| A0A183L8I5 | 287-376 | None |
| G5BNB0 | 221-339 | None |
| A0A834CC39 | 692-823 | None |
| Q86EW6 | 89-202 | None |
| A0A3P7SM77 | 29-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.