DPCstruct | MC3020
Metacluster Properties and Pfam Annotations
| Number of structural domains | 105 |
|---|---|
| Mean domain length (aa) | 201 ± 28 aa |
| Standard deviation of domain lengths | 28.32 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.89 |
| Pfam Score | 48.38 |
| Assigned Pfam label(s) | CL0016- PF15982- PF02466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0C7N4 | 52-252 | QLVSFVARFVKQHPQLQVKTPFCQHEHGCLYNVLEGLVRSFGIAYTMKALFGLISALLSKNKKISKGSLILEAFIGIDTLKFASFPT… |
| A0A4U7KV47 | 4-204 | LEKRLTQIALNPAYHDIFTIIKGFRNGIVYGAKIRFPHALVMTFLFGRGTPREKLTFILRATKQHALNLGTFTPLYKFLTIAMRRAY… |
| A0A4Y2CSX5 | 12-182 | None |
| C4JIJ6 | 5-180 | None |
| A0A1S8VES2 | 28-249 | None |
| A0A099P2N5 | 1-165 | None |
| R9P914 | 8-213 | None |
| A0A7R9KS87 | 118-342 | None |
| A0A2D4FUT5 | 1-156 | None |
| A0A1X2IGD2 | 46-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.