DPCstruct | MC302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 151 ± 20 aa |
| Standard deviation of domain lengths | 20.24 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 94.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0FAK4 | 6-126 | QSEMDLLRKLNYTKAEGPAKGQPMLNTAIDAAEMILTLAPETNGQVAVKAWAALSEFTGRDHTHLALNKEDEKIRFRDIQAQPRKII… |
| A0A6N9XY95 | 1-149 | YTAVAAKMAALGPLVDKGTSTKGVSWVPTEAVDYLRQANGVVHGGVADGRPSLSLDVHMAEAILALSGTTNGRISVLGWKDLEKRTG… |
| A0A7V0PM57 | 286-436 | None |
| A0A7M3ZB36 | 895-1042 | None |
| A0A2X3CHN9 | 212-393 | None |
| A0A380FMP6 | 4-137 | None |
| A0A379WSQ4 | 1-144 | None |
| A0A7C5L3H1 | 245-397 | None |
| A0A378F4Z1 | 445-592 | None |
| D4DNV1 | 289-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.