DPCstruct | MC30196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 119 ± 19 aa |
| Standard deviation of domain lengths | 19.30 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1CE94 | 2-118 | TSGMTKPTKWLHSDEQLAPESGVSYELRYIGSMPVRVSIKAVDLETRTRIAHASIHQVCEDVGRKLPRTTRPNKTLEMYLGAESDKN… |
| A0A016SVQ8 | 1-112 | MALPPTAPELRGSGIQFTFEYLGSVPVLAALHDMTPDLRPLVVKECINMIAGEIGIIPVQETNAIIKLFVGTPEVANHRIDLNISTK… |
| A0A183HLS0 | 1-101 | None |
| A0A4U5LV33 | 4-113 | None |
| A0A2G8LMA0 | 24-123 | None |
| A0A183MUU7 | 1-129 | None |
| A0A6P4YRC4 | 1-83 | None |
| S9XBU8 | 1-94 | None |
| A0A4Z2B945 | 32-154 | None |
| A0A1L8HX44 | 126-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.