DPCstruct | MC30194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 151 ± 22 aa |
| Standard deviation of domain lengths | 22.38 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4T883 | 1-140 | FEPPPHTTSSIYPLPSVVFRFFDYADCPDDGPVLPGAHSIERFLVEEELRWILDQEKTNRKKCASRLLEYDKRTLVPINYVILEVIF… |
| A0A2H1CBX3 | 1-192 | MLKLEKVMFLDHDVYYIPHYLPIIFALIQITPPEYDTEVVYPVPRVIFRMFDYTDVIDQDDDNVVTAADGSPKPKESPVLPGAHTIE… |
| A0A2A2K1X5 | 418-562 | None |
| A0A3P6S9B4 | 2-115 | None |
| A0A3P6S7V7 | 3-162 | None |
| A0A3P7LFB5 | 132-277 | None |
| A0A183JKE8 | 61-242 | None |
| A0A0N4YK42 | 477-619 | None |
| A0A6P4JCY1 | 291-428 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.