DPCstruct | MC30193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 184 ± 22 aa |
| Standard deviation of domain lengths | 21.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1CBN2 | 11-179 | DELIPALIQCFGVIVLGYLTGRWNLLSESQALGLNAYVTKFALPAVFFRVMVSIDFSGVCWYMVSAISVSKLIAFVLAFVITVLLSR… |
| A0A182SP31 | 1-149 | YLAGRLNIISNFEAKGLNTFVGTFALPSVIFLSLAELNWSTVNWNFLLSILIAKTIVFLSVAIISLLVARPVNYGRAGLLAIFCTQS… |
| A0A4S2M988 | 1-148 | None |
| A0A3L6SLT5 | 6-182 | None |
| A0A183NSC7 | 27-212 | None |
| A0A4W5MJX0 | 23-195 | None |
| T1HD39 | 6-195 | None |
| A0A2S6RAC8 | 2-184 | None |
| A0A6P6Y5K4 | 1-206 | None |
| A0A4D9CR45 | 31-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.