DPCstruct | MC30190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 485 ± 78 aa |
| Standard deviation of domain lengths | 78.42 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 15.62 |
| Pfam Score | 88.06 |
| Assigned Pfam label(s) | CL0715- PF07159- PF14744 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7F222 | 53-521 | LESAVKFIVRKFPAVETRNNNLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDACQVFFDITVNFDLTKNYLDLVVTYT… |
| A0A2H1CA79 | 50-541 | QSSAFSLRTLSRRRTGLRAVEYHAGAGSRVRNNALYLAVHLTRFALCMFFTCWLSTNFLFLPTQIRSNEQPHRMEIYQKTVEILEPY… |
| A0A6U0K852 | 92-682 | None |
| A0A388L3X4 | 36-616 | None |
| S4RDB4 | 20-456 | None |
| A0A5B7DH87 | 302-639 | None |
| A0A1S8VI82 | 25-566 | None |
| A0A3N7G3U3 | 3-508 | None |
| A0A1I8FKE2 | 30-475 | None |
| B4HB69 | 32-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.