DPCstruct | MC30187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 120 ± 26 aa |
| Standard deviation of domain lengths | 26.41 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.70 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | CL0243- CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K2GSS4 | 2-85 | SIVFTYLYPRIDTNVSVQLNHLLKAPFCIHPSTNKVCVPINFNTIDSFDPNKVPTLQSLQESKLLSFYSFNDSIELFSRFVKES |
| A0A2H1C7I7 | 61-183 | WNTLRAFLTERGRMNVLKQLVLTYTYPRLDVNVSTSLNHLLKSPFCIHPKTGHVCIPFDPRYVDSLEPFSAPTLPQLIDELGVRTGQ… |
| A0A158RF90 | 658-786 | None |
| A0A2U1PJQ5 | 295-440 | None |
| A0A7R9CWP5 | 308-467 | None |
| A0A2A3EBZ6 | 277-419 | None |
| A0A182IMP8 | 834-974 | None |
| A0A7S4M786 | 32-138 | None |
| A0A0B7N1I4 | 302-453 | None |
| A0A0M3IFA9 | 6-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.