DPCstruct | MC30186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 61 ± 6 aa |
| Standard deviation of domain lengths | 5.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 57.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0068 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4IMK6 | 244-300 | PKSLIDPVPSGKQAKDYVTEAITPTLTAGLVELCRTKPANPVQWLAAWLASNNPNSP |
| A0A2H1C6H4 | 1-56 | MEPIPMKIAAKDYLARNINPTLLRGLTEVCKQKPKDPVPWLADWLLENNPNRPSIS |
| A0A654HUA7 | 56-117 | None |
| A0A068Y9K4 | 2-65 | None |
| A0A6S7FFK9 | 17-72 | None |
| A0A482VHA0 | 108-171 | None |
| A0A4W5L343 | 47-103 | None |
| A0A7M3RA92 | 753-812 | None |
| A0A7R9K6M7 | 227-283 | None |
| A0A7J6BKH1 | 154-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.