DPCstruct | MC30185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 106 ± 20 aa |
| Standard deviation of domain lengths | 20.25 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 48.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1C6F4 | 26-116 | FSSHVFVHRDSPQNNPKTPFDFTPENKARLDAIIANYPKNYKSAAILPALDLAQRQNGWLSISCMNKVAELLEVPRMRIYEVATFYT… |
| A0A0Q6EKH9 | 8-86 | EDSVQPAAFAFHPENAEWAEATIRKYPEGRQQSAVIPLLMRAQEQDGWVTRAAIESIAQMLSMPLIRVLEVATFYTQFQ |
| A0A7S1QVG0 | 7-108 | None |
| A0A5J4YVM0 | 48-190 | None |
| A0A7I4D7R2 | 1-151 | None |
| A0A4R0RCW8 | 620-723 | None |
| B6JV17 | 25-114 | None |
| A0A4Z2DEZ2 | 2-119 | None |
| D4D2Z8 | 95-239 | None |
| M1W2Q5 | 525-632 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.