DPCstruct | MC30184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 176 |
|---|---|
| Mean domain length (aa) | 186 ± 34 aa |
| Standard deviation of domain lengths | 33.86 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.28 |
| Pfam Score | 94.76 |
| Assigned Pfam label(s) | PF16752- CL0391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S9V2V6 | 2-122 | TVDDCDGGELIIAACEGSVFLRNCKNMTVHVACKQLRTRDCENVELHIFTTTDPVVEMSHHMTFRPFHLRLPGLQQSFKAARLDPRL… |
| A0A2H1C6G7 | 38-238 | TKNRVQKTTTPAVSEVTPTSEITEHSGHIPSSLTKFDERFSLTNFEHDCQLVIPKPGCTDTIGVENSVYLAQLNRCTVHVRDVCGNL… |
| A0A080ZX82 | 223-437 | None |
| A0A1E4SMJ2 | 3-145 | None |
| A0A0G4LFY0 | 390-603 | None |
| A0A6V7WL00 | 8-172 | None |
| L1LGI2 | 96-299 | None |
| A0A7S3LV17 | 5-172 | None |
| A0A433PM20 | 21-260 | None |
| A0A498NB66 | 311-473 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.