DPCstruct | MC30183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 7.85 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 57.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0234 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J1J7I7 | 730-811 | MAYMFGFFFGKTPLIKLSPKKTWEGFIGGGFATVIFGVVFSYFLCRYQYFVCPIEYSETAGKIVLDCEPSYLFRPQEYGIRI |
| A0A6P5W7V9 | 249-330 | MAYVFGFFFGRTPLIKLSPKKTWEGFIGGGFATVLFGILFSYFLCNYQYFICPIQYSEELGRMTMSCVPSYLFTPQEYSLKV |
| A0A822D3E3 | 87-168 | None |
| A0A7R9E375 | 572-669 | None |
| A0A7R9ADV0 | 176-264 | None |
| V5ICU4 | 21-118 | None |
| A0A7R8VIY5 | 46-117 | None |
| A0A183NQR4 | 1-90 | None |
| A0A7R9I1T1 | 1-100 | None |
| A0A813XB52 | 697-783 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.