DPCstruct | MC30182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 110 ± 15 aa |
| Standard deviation of domain lengths | 14.83 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1C5H4 | 7-119 | SLLTPYGPCTSDSCGYCKGGAEVERHTWGMGATSLTVSDYQYLIDRGWRRSGTYCYKPINTNTCCPAYTIRCDARHFHPSRAHKRIL… |
| A0A452Z833 | 1-80 | RRTTCGYCRSTGPTSISHGLWANSLKADDYQALLDRGWRRSGSFLYKPEMERTCCPAYTIRLKASDFICSKEQDRVLKRM |
| A0A6A6L6M9 | 14-113 | None |
| A0A2B4SV46 | 5-108 | None |
| B6K0Y7 | 5-112 | None |
| A0A6V7U5L8 | 28-139 | None |
| A0A817CZT7 | 40-146 | None |
| A0A5J4WNT3 | 2-95 | None |
| A0A4Y7T7N1 | 7-125 | None |
| A0A7C8QJ80 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.