DPCstruct | MC30180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 50 ± 3 aa |
| Standard deviation of domain lengths | 3.17 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 73.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 49.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3RKU7 | 37-87 | SIRRVNCVIGRTERREVAYIAREPSGQVYRRLCHLFRTKSSHQVWTFHFFL |
| A0A0N4TDP6 | 6-56 | LFCQSIRRVNCVIGRTERHEVAYIAREPSGQVYRRLCHLFRTKSSHQINKE |
| A0A7E4S3M1 | 1-54 | None |
| A0A5K3EJ91 | 94-141 | None |
| A0A5E4PT38 | 68-114 | None |
| A0A139WMD5 | 50-103 | None |
| A0A5E4MUS5 | 33-77 | None |
| A0A0M9A3C1 | 122-176 | None |
| A0A6A0HF59 | 37-84 | None |
| A0A2H1WFM5 | 69-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.