DPCstruct | MC3018
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 6.47 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18798 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N2BJA3 | 678-759 | TYILREQTKEILTSLIGKNITNQNDGRIAQISRKNIAKMTSDKAIQKSIDNGFTPQEHFKAVQDIENLYQGAILRETHKDKK |
| A0A347VSU6 | 1-99 | MNKDSINKIEITTKNIDRQPYEWREYLKTTLRPFVNKPIANIYDGRVAMLPYGNIGKLSSETAVEKSKANGCNESEHFAAAEQILNL… |
| A0A1Q2LFS4 | 20-113 | None |
| A0A381EFV2 | 824-903 | None |
| T1CMN5 | 17-98 | None |
| A0A826GD41 | 809-894 | None |
| V8CCG2 | 3-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.