DPCstruct | MC30179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 82 ± 14 aa |
| Standard deviation of domain lengths | 13.87 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 30.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P7HAN4 | 309-377 | VDYLGVGYGATADLLDFWAENGYRTVHLSTTKNDASGEHSALMVRPLTDDGADLAARHAEWFRERAPGV |
| A0A380TL87 | 396-472 | KQKQPLVDFISVSFGQTEALTYFWQQCSFELVQITPNKEASSGYYSAMMLYPLTEKGKQFVKKAQMQFSRNQALLHL |
| A0A2X1QQ99 | 1-68 | None |
| A0A2F0AT31 | 208-294 | None |
| A0A1Q9CXA8 | 310-403 | None |
| A0A318N3T6 | 500-570 | None |
| A0A7R7GDE8 | 456-548 | None |
| A0A183CX09 | 368-424 | None |
| A0A3M1UHJ0 | 564-647 | None |
| L0E3M3 | 433-537 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.