DPCstruct | MC30177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 119 ± 15 aa |
| Standard deviation of domain lengths | 14.81 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 51.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0145 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F5XY06 | 11-126 | DLQDRYTQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKF… |
| A0A3S5FFH6 | 1-111 | MRSDQSTTHKLKNAYWTTKQVVIKKLGRKEDEHLVASDCELDSKLELFKIVQKTCLDLSLTTERYEEVICLLSQSENELGRFLKYRG… |
| A0A836D993 | 408-509 | None |
| A0A0N1INE0 | 4-100 | None |
| A0A3P7DFK2 | 14-133 | None |
| A0A7R9FFN5 | 111-239 | None |
| A0A1W0WDZ9 | 1-141 | None |
| A0A2S2NXK5 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.