DPCstruct | MC30175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 82 ± 7 aa |
| Standard deviation of domain lengths | 6.87 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0261 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1C3J0 | 3-100 | ILQIHRWEVNAEWTRSTTSVFQVYRGYVDDPRNTDNAWMETVAVNFHDETGQKIAKFNLKAGDDARNVRWMDVDSELNLYANHREFI… |
| A0A0M0JH69 | 43-122 | SGQVVYRGYVDDPRNTDNAWMETTAFHFHCDAEMGALLPLHAGDDAADVTWLDVDEADERYAGLYASHKQWVDQVAATLK |
| A0A183TAI2 | 17-109 | None |
| R1DEE8 | 14-80 | None |
| A0A8B6BRU8 | 21-99 | None |
| X6MKC9 | 50-126 | None |
| A0A654HKC4 | 216-295 | None |
| A0A5E4Q162 | 56-132 | None |
| A0A0L7L8L7 | 56-140 | None |
| A0A183WDR5 | 35-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.