DPCstruct | MC30172
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 110 ± 8 aa |
| Standard deviation of domain lengths | 7.58 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7PFN4 | 264-372 | NPEYILCYIDYLSHLNEDNNTRVLFERVLSSGSLEPEKSVDIWNRFLEFESNIGDLASIVKVEKRRSAVLGQIKEFEGKETAQLVDR… |
| A0A2H1C2P5 | 7-111 | NADYILCYVDFMAHLNEDNNIRVLFERALGSNQIAPERSRLIWARFLQFESQVGDLASILKVEKRRLQSLESIKEASRLESALLIDR… |
| A0A1U8PBK5 | 9-113 | None |
| A0A7J9CWQ2 | 148-285 | None |
| K1PMJ9 | 452-565 | None |
| A0A0V0XQN0 | 440-542 | None |
| A0A316UES1 | 800-911 | None |
| A0A1D6M354 | 1-112 | None |
| A0A183RLZ5 | 8-115 | None |
| A0A1E3PJY5 | 471-584 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.