DPCstruct | MC30167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 388 ± 28 aa |
| Standard deviation of domain lengths | 28.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7PYZ8 | 134-497 | LLSPPTVKDSAHALFVRAIYLVCHRLISSWKSDVNVSLAGLELLSGLARLNIAEQDGLECKRAVKWLCDYIAYQCSRPPRAHSKDLH… |
| A0A2H1BXK4 | 1-454 | MAVDEAMTGVMKSQKYSGEMKKRLDQTRTNSPIPDTAWGFFNALVPCLCGLLDREPVVQFVLEILGGVSAVRISPPDPIMYSDLYFC… |
| F1KQJ0 | 838-1212 | None |
| A0A286Y9P2 | 726-1099 | None |
| A0A0N4V331 | 127-481 | None |
| A0A183KJV6 | 1-399 | None |
| A0A3Q0KMD7 | 923-1325 | None |
| A0A7M3RDC8 | 445-865 | None |
| V9IM17 | 185-545 | None |
| A0A3B3SGF0 | 719-1087 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.