DPCstruct | MC30166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 90 ± 13 aa |
| Standard deviation of domain lengths | 12.97 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05502 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9DSD4 | 40-124 | VCHEVESHFCANCLENIPLAEARMKKNRCATCFDCPSCTHTMSTRAVPISTPNPDDPKKVITRKVYYLVCGFCRWTSRDIGLPDQ |
| A0A016RS92 | 57-133 | SLNEIDSTFCPNCLENIPAGEARVKRNRCVNCNQCPICSMVLTTRAVGESCHLMCSTCRWSTRDSDTPDQPSSINWP |
| A0A1R0GV52 | 66-167 | None |
| A0A0R3QM79 | 75-168 | None |
| A0A5N4AX15 | 45-154 | None |
| A0A016RRY4 | 96-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.