DPCstruct | MC30158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 156 ± 15 aa |
| Standard deviation of domain lengths | 14.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1BSH1 | 20-175 | TLPQSMLLFNRSYIRVKDILIICHPVPQLATFSYPRMKCTGLVDGNRLTWFDLGPMISQIITYQNEDKRFFAVGPERSSILSTREPT… |
| A0A7R9QXS6 | 62-213 | PNTWFSDSNERLNRHFSADSYNNVIYFCDSTSDMNHQVCYYSNSGGSTWNIIGRSIDTIQGYELSSGKIFAIDSERPAYLSSKDGLK… |
| A0A7D9DXB9 | 591-734 | None |
| A0A5K4F3W0 | 1642-1787 | None |
| A0A5K4F3Z9 | 21-175 | None |
| A0A5K4F6D1 | 120-293 | None |
| A0A7M5UUD8 | 150-291 | None |
| A0A4E0RTZ0 | 29-183 | None |
| A0A4E0RTL5 | 86-249 | None |
| A0A444SFW3 | 19-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.