DPCstruct | MC30157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 138 ± 16 aa |
| Standard deviation of domain lengths | 16.13 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 43.56 |
| Pfam Score | 81.68 |
| Assigned Pfam label(s) | CL0023- CL0431- PF02881 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7WTT2 | 1-104 | MDFFLKGSLIKILVKNVAAEPAEKICQSVGRKLEGKVIGTFSRVNTEVKDAVRESLTQLLTPKRRVDILRDVLEAKREHRPYVIVFC… |
| A0A2H1BSH2 | 5-154 | SSVSLTLTPRQTKTSSVGSGAGGGLVSSLLRGLRLPVGSSRVLTLEDITPSLEQLRDRLVAKNVAMEIAQRVCDSVADRLVGTSLGA… |
| A0A1A8IVM5 | 3-120 | None |
| A0A218ZDS3 | 337-476 | None |
| A0A7J6SMY6 | 136-268 | None |
| A0A815G6C1 | 306-455 | None |
| A0A654H6T9 | 311-462 | None |
| A0A6B9V8X6 | 1-126 | None |
| A0A834J1R2 | 316-451 | None |
| A0A3P7NWD8 | 321-452 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.