DPCstruct | MC30151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 136 ± 22 aa |
| Standard deviation of domain lengths | 22.34 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A252E5J3 | 105-223 | MDKPSKREIADICTELRRLRINPEPCLGVMKKYWVNVQGAIARVKEAIHDGWCDNPTGLFINSCKSGAKGKNTVTSDVSAWFEWARQ… |
| A0A2T1EDJ8 | 1-167 | MDLLRKQNRELLASWQASQKEKVINLSVQNSLPIQNTSTQVEVALEQASIKLSPKLNKEIRQHSPEAVLKAIDAFKQYRTEHTIQKP… |
| A0A2K3B3Z6 | 190-336 | None |
| T2JIL2 | 3-176 | None |
| A0A367RVH8 | 1-105 | None |
| A0A1Z4K9Q8 | 344-460 | None |
| A0A2T1BWW2 | 1-130 | None |
| A0A2T1BWS6 | 8-106 | None |
| A0A2T2W6B1 | 5-153 | None |
| A0A6H9GR21 | 190-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.