DPCstruct | MC3015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 774 ± 38 aa |
| Standard deviation of domain lengths | 37.61 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 13.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A142D1J5 | 24-762 | IAYSLIDEIDQGILPYVKNYSQYAVDKIDVKELVGDNIRYYLAAKTEGMESHFEKWNVFISEYDLLLKKVLKNGLCSVNPDTLDAML… |
| E5B152 | 93-804 | VNFETLANQSELIKFALISGDSRLLLNIEGPGAEEGLTLPLLFDQNRFNKLFKEEGNATWNRMKGRVILDNTEHNVVGVRQQLLALE… |
| A0A376TMX5 | 130-880 | None |
| A0A6G8CI88 | 431-1203 | None |
| A0A661Q716 | 2-802 | None |
| A0A150SUN3 | 264-1102 | None |
| A0A1C7DEG8 | 426-1243 | None |
| A0A810MCU5 | 45-814 | None |
| A0A846TF21 | 23-781 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.