DPCstruct | MC30148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 196 ± 10 aa |
| Standard deviation of domain lengths | 10.46 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 26.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05218 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A8XTH0 | 411-593 | ELNRMRYETHQSIAAFLACIQLRLRFEEKEDEWSTSLKKLRQPLISLKTAYYDLQNEMNYFDPNDEFSNLQSECRFFSKKIEDAQNM… |
| A0A1I7V4J7 | 1-209 | KETERIRLENLEKFNLAISAFWKCLEMKLNWEMIENNWEESLKGLRSLVSQTKIQFSRLKDSMRFCENFDRDDVEYLKEELEILHSS… |
| A0A2G5TN66 | 250-437 | None |
| A0A2G5T742 | 2-187 | None |
| Q22880 | 1-210 | None |
| G0NWD5 | 482-688 | None |
| A0A1I7UGG2 | 322-520 | None |
| A0A1I7SYZ6 | 57-260 | None |
| A8XDG2 | 696-882 | None |
| A0A6A5HPA7 | 165-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.