DPCstruct | MC30147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 139 ± 10 aa |
| Standard deviation of domain lengths | 10.31 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.62 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | CL0192- PF01579 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0MT64 | 114-257 | NAQKCLPMKTDIAQKVLQTPKNAKVNDPAWLKLINSCDRAKACLDENCYFDEKEKIKLNEYCEIIELGNTEFSMCQKKILKEYPDLS… |
| A0A1I7V2C1 | 18-143 | KINDTRILDVIKECKKIQVCIEPTCFPEVTKNTMAIACIGIEIQNTEYTKCGMQLNNMTDFSNYDCLEGADFDSEEFTDVMFTSKKE… |
| G0M9W7 | 15-162 | None |
| A0A2G5TPE7 | 30-167 | None |
| A0A2G5T983 | 1-114 | None |
| A0A2G5T8X9 | 21-164 | None |
| A0A2G5T8Y3 | 116-251 | None |
| A0A2G5T8T5 | 4-126 | None |
| A8XVY1 | 253-396 | None |
| A0A1I7V2C4 | 122-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.