DPCstruct | MC30143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 389 ± 50 aa |
| Standard deviation of domain lengths | 50.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02206 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7UTB2 | 1-397 | MNGFQMRVLLYPTPLSPRIVASKEIPLVDFLPEDSSPAHPHLKRASPDNLKPSVQRVQKVARIINGIYIQQGVITASIPSDELISEL… |
| A0A1I7TQE8 | 2-343 | KYLFDKTSIIARISNGISLQSGLLNGSIPIHSAIEELLGLDSNSNRSIFQSDQMTFLVSKLKSMSKPVDSSIKNLETTVISLNNLRI… |
| A0A2H2IUJ4 | 43-404 | None |
| E3NW36 | 3-374 | None |
| A8WNU7 | 27-357 | None |
| A0A6A5GX53 | 1-433 | None |
| E3NP98 | 1-496 | None |
| Q9BKX2 | 258-638 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.